Anti-NAIP antibody produced in rabbit

• Catalog No.: HPA042438
• M. F.: C15H17ClN2
• M. W.: 260.76188

SYNONYMS

• IUPAC name: [3-(4-chlorophenyl)-3-(pyridin-2-yl)propyl](methyl)amine
• IUPAC Traditional name: [3-(4-chlorophenyl)-3-(pyridin-2-yl)propyl](methyl)amine
• Synonyms: Anti-Birc1; Anti-Nlrb1; Anti-NLR family, apoptosis inhibitory protein

DATABASE IDS

• MDL Number: MFCD01322381
• Human Protein Altas number: HPA042438 Human Protein Atlas characterization data

PROPERTIES

• Antibody Form: affinity isolated antibody
• Application(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
• Application(s): protein array: suitable
• Clone: polyclonal
• Grade: Prestige Antibodies® Powered by Atlas Antibodies
• immunogen sequence: KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
• Shipped in: wet ice
• Species Reactivity: human
• Gene Information: human ... NAIP(100510700)
• Apperance: buffered aqueous glycerol solution
• Storage Temperature: -20°C

DETAILS

Description (English)

Immunogen
NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST)
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Application
Anti-NAIP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Features and Benefits
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Description (简体中文)

Application
Anti-NAIP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Features and Benefits
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen
NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST)
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
法律信息
Prestige Antibodies 注册商标 Sigma-Aldrich Co. LLC