[3-(4-chlorophenyl)-3-(pyridin-2-yl)propyl](methyl)amine

• ChemBase ID: 132087
• Molecular Formular: C15H17ClN2
• Molecular Mass: 260.76188
• Monoisotopic Mass: 260.10802623
• SMILES: CNCCC(c1ccc(cc1)Cl)c1ccccn1
• Canonical SMILES: CNCCC(c1ccccn1)c1ccc(cc1)Cl
• InChI: InChI=1S/C15H17ClN2/c1-17-11-9-14(15-4-2-3-10-18-15)12-5-7-13(16)8-6-12/h2-8,10,14,17H,9,11H2,1H3
• InChIKey: UICFCNIVUDNZSW-UHFFFAOYSA-N

NAMES AND DATABASE IDS

Names

• IUPAC name: [3-(4-chlorophenyl)-3-(pyridin-2-yl)propyl](methyl)amine
• IUPAC Traditional name: [3-(4-chlorophenyl)-3-(pyridin-2-yl)propyl](methyl)amine
• Synonyms: Anti-Birc1; Anti-Nlrb1; Anti-Neuronal Apoptosis Inhibitory Protein; Anti-NAIP antibody produced in rabbit; Anti-NLR family, apoptosis inhibitory protein

Database IDs

• MDL Number: MFCD01322381
• PubChem SID: 162226364
• PubChem CID: 161321
• Human Protein Altas number: HPA042438 Human Protein Atlas characterization data

CALCULATED PROPERTIES

• H Acceptors: 2
• H Donor: 1
• LogD (pH = 5.5): -0.02526304
• LogD (pH = 7.4): 0.5569316
• Log P: 3.2019029
• Molar Refractivity: 75.5556 cm^3
• Polarizability: 29.706104 Å^3
• Polar Surface Area: 24.92 Å^2
• Rotatable Bonds: 5
• Lipinski's Rule of Five: true

PROPERTIES

Physical Property

• Apperance: buffered aqueous glycerol solution; buffered aqueous solution; lyophilized powder

Safety Information

• German water hazard class: -; 3
• Personal Protective Equipment: Eyeshields, Gloves, type N95 (US), type P1 (EN143) respirator filter
• Storage Temperature: -20°C

Pharmacology Properties

• Gene Information: human ... C1orf176(64789); human ... NAIP(100510700); human ... NAIP(4671)

Product Information

• Grade: Prestige Antibodies® Powered by Atlas Antibodies
• Application(s): immunocytochemistry: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; protein array: suitable; western blot: 10 μg/mL; western blot: suitable
• Shipped in: dry ice; wet ice
• Clone: polyclonal
• Species Reactivity: human
• Antibody Form: affinity isolated antibody
• immunogen sequence: KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD

DETAILS

Sigma Aldrich - HPA042438

Immunogen
NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST)
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Application
Anti-NAIP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Features and Benefits
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Sigma Aldrich - N6648

Immunogen
synthetic peptide corresponding to amino acids 473-490 of human NAIP sequence.
Physical form
Lyophilized from a 0.2 μm filtered solution in phosphate buffered saline.

Sigma Aldrich - PRS3315

Immunogen
a synthetic peptide corresponding to 13 amino acids at the C-terminus of human NAIP.
Physical form
Solution in phosphate buffered saline containing 0.02% sodium azide